PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.B01339.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 246aa    MW: 26388.8 Da    PI: 6.6855
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.B01339.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF62.54.6e-201662147
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                    k+i+n+  rqv fskRr+g++KKA+ELS+LC+a v  i+fs  g+ +
  Pahal.B01339.1 16 KPIQNEEARQVCFSKRRQGLFKKASELSILCGAMVGTIVFSAAGRSF 62
                    68***************************************999755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.628868IPR002100Transcription factor, MADS-box
SMARTSM004322.1E-29867IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.05E-25981IPR002100Transcription factor, MADS-box
CDDcd002653.38E-33978No hitNo description
PRINTSPR004041.1E-181030IPR002100Transcription factor, MADS-box
PfamPF003191.8E-231864IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-183045IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-184566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MVKGQKSKGR QKIEIKPIQN EEARQVCFSK RRQGLFKKAS ELSILCGAMV GTIVFSAAGR  60
SFSFGHPSID EIISRFLNSV NPNGPASGGP SHDNGGSVTD AVSKLNMELL ELEQSLESEK  120
KRKERLQEAT EKEMGGRMMQ WLNANVFELG LDELQEFQKK LEEIQAIVKE KINEVMAEAR  180
HTPGSLPQPP MDVASTSQSA NPLASTAPSS SAAPIDGSEI NYALLSGGVH GVGGLGNFPS  240
NQNHG*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012699030.11e-137PREDICTED: agamous-like MADS-box protein AGL29
TrEMBLK4A0041e-136K4A004_SETIT; Uncharacterized protein
STRINGSi032189m1e-136(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122436128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.13e-28AGAMOUS-like 62